Protein Info for SMa1198 in Sinorhizobium meliloti 1021

Annotation: copper export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 152 to 175 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details PF04234: CopC" amino acids 38 to 129 (92 residues), 72.7 bits, see alignment E=4.2e-24 PF05425: CopD" amino acids 320 to 419 (100 residues), 81.2 bits, see alignment E=6.6e-27

Best Hits

KEGG orthology group: K14166, copper transport protein (inferred from 100% identity to sme:SMa1198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z43 at UniProt or InterPro

Protein Sequence (541 amino acids)

>SMa1198 copper export protein (Sinorhizobium meliloti 1021)
MNKPRLDGRRWDAPARMLGISVLACSAWLWLAATAFAHASLVETIPADNAVLAESPATFS
MTFSEAVSPLSLKLVGPDGSSVSLERYEPRDRTLEVEPPSSLVRGTHVLVWRVISEDGHP
IGGSVIFSIGPPGATPRAAAVKIDGEVGTAIWLAKVALYLGLFLGIGGSFALSWLGRVER
SGTVTVHIILGIGLFGALLSVGFQGLDALAAPLRRLADSATWQAGMSTSFGRTSVVAVLA
SAMAIFALVAKGGWGRLLSLAALIGTGLALALSGHASAAEPQWVTRPMVFLHGVGIAFWT
GALIPLGLALARRTPESGYMLRRFSNTIPLVLALLIIAGMVLAVVQVRNLSALVETAYGA
VLLAKLALFVLLFALAVFNRLRLTEPAERRDAPAARRLARSIAIETVVAVLIFGVAAVWR
FTPPPRALEIAAAQPATVHLHAPRAMANVRLSPGRAGQVAASIEVFSKDAKVLTPKEVTL
VLSNPASGIEAIRRPAQRAGEANWRVDGFVVPLPGTWHVRLDLLVSDFELVKLEGEVDIR
R