Protein Info for SMa1194 in Sinorhizobium meliloti 1021

Annotation: NnrS dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details PF05940: NnrS" amino acids 4 to 363 (360 residues), 217.5 bits, see alignment E=1.9e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1194)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z46 at UniProt or InterPro

Protein Sequence (393 amino acids)

>SMa1194 NnrS dehydrogenase (Sinorhizobium meliloti 1021)
MSSIWRAPYRPLFFLAGLWALIVPIVWLLPEQLVPDRVEWHSRELLFGMGGAAAGGYLLT
ALPAWTRGAVPPAATVIATCLWCAARLTGAFSDHLPLIAAAIGVSGYFAFLTAMLMRGVV
VSRAWARCWAPLGTGALGVNAFVSIADGPSPTPLLFAALIVVVGGRAVPAFTGSWLYRTA
GGKSLRNRRELSHLAVAGILIATFLHGDWSPTLPGLLLLFSGAMLLWQMSEWRSLGTRGY
PALFILHVAFAWTPTALLLGGLSATISGHVPADDALHALTMGAMGTMIAAFMMRPAMVRD
GESLILGGTMAGAFSLVSLSALLRTSGGWLDADHFEPEAAAAICWMAGWTLFLIAYLPAM
SGPVPRPAFSAALGNQVKRGNGTPPWKAGCLCP