Protein Info for SMa1142 in Sinorhizobium meliloti 1021

Annotation: FixL-related histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 TIGR00229: PAS domain S-box protein" amino acids 27 to 153 (127 residues), 119.6 bits, see alignment E=4.6e-39 PF00989: PAS" amino acids 31 to 142 (112 residues), 68.3 bits, see alignment E=2e-22 PF13188: PAS_8" amino acids 31 to 86 (56 residues), 29 bits, see alignment 2.5e-10 PF08448: PAS_4" amino acids 36 to 148 (113 residues), 27.3 bits, see alignment E=1.3e-09 PF13426: PAS_9" amino acids 40 to 144 (105 residues), 48.1 bits, see alignment E=4.3e-16 PF00512: HisKA" amino acids 163 to 224 (62 residues), 32.3 bits, see alignment E=2.9e-11 PF02518: HATPase_c" amino acids 268 to 389 (122 residues), 72.4 bits, see alignment E=1.4e-23 PF00072: Response_reg" amino acids 416 to 506 (91 residues), 53.4 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1142)

Predicted SEED Role

"Two-component oxygen-sensor histidine kinase FixL" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z74 at UniProt or InterPro

Protein Sequence (528 amino acids)

>SMa1142 FixL-related histidine kinase (Sinorhizobium meliloti 1021)
MEKRVEMVEETVSDIADLKSAQADVAAREAHLRSILDTVPEAMVVIDSKGVISSFSAAAE
RLFGYTESEVVGLNVKVLMPSPHREAHDQYLNNYLRTGERRIIGIGRVVTGLRKDGTTFP
MELSVGEATSDGRRIFTGFIRDLTSRQRIENELRQAQKMEAVGQLTGGLAHDFNNLLTVI
TGNLEMIEARLQDEKLMPLLQEAQAAADDGAKLTAQLLAFGRRQPLNPKLVDVGELVTNF
SKLLTRTLGETIELSTVVKGSANLALIDVSQLQNTVLNLGLNARDAMPNGGRLTIEVSTT
VLDRDYALMLPEVRMGHYVLVAVTDTGVGMTEEVKRHAFEPFYTTKGFGAGTGLGLSMVY
GFVKQSGGHIQLYSEPDRGASVRLFLPAAEGENQLAEIGAAEEAAPQPMPRGHETILVVE
DDARVRRVVVARLRDAGYSVIEAEAGTKALQLLAEHPEVSLVFTDMIMPGGIDGGELAEH
VRALRPDVKMLFTSGYAEPSAAGRAVGSWLQKPYTARALALRLRELLD