Protein Info for SMa1131 in Sinorhizobium meliloti 1021

Annotation: Metallo-beta-lactamase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF00753: Lactamase_B" amino acids 16 to 80 (65 residues), 47.4 bits, see alignment E=5.9e-16 PF16661: Lactamase_B_6" amino acids 22 to 170 (149 residues), 28.7 bits, see alignment E=2.1e-10 PF12706: Lactamase_B_2" amino acids 29 to 133 (105 residues), 29.5 bits, see alignment E=1.4e-10 PF10996: Beta-Casp" amino acids 259 to 378 (120 residues), 112.5 bits, see alignment E=4.7e-36 PF07521: RMMBL" amino acids 392 to 446 (55 residues), 58.1 bits, see alignment 1.8e-19

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 100% identity to sme:SMa1131)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z81 at UniProt or InterPro

Protein Sequence (531 amino acids)

>SMa1131 Metallo-beta-lactamase superfamily protein (Sinorhizobium meliloti 1021)
MMIEPTIRFDGAAGTVTGSCQLVEFGATKILVDCGLFQGSKTEKELNYRDFPFDPKTIDA
VILTHAHIDHSGLLPKLARLGYDGPIFATPATTDLCSVMLPDSAHIQESEVDQLNRRNLR
RGRQTVTPIYTPRDAAVAITLFRQVRLGSWETVGEGIRFRFWNAGHLLGSASVEMEIGTG
PSPLRLLFSGDIGPRHKLLQFDAKAPSGWDYVICESTYGNIEREEADDAARRHILRSEVL
TAAHPNGALLIPSFAVERTQELLTDLVHLMETGAVPKCPIIIDSPLATRASEIFRRHARE
LENGDALVRGIESKNVRFTETAEQSKAVDLIRGFHIVIAASGMCEAGRIRHRLKNWLWRD
EATVLLVGYQANGTLGRLLEEGATVVRIQGDDIRVRARIRKLDIYSGHADGSELADWVRA
RQPISAGVFLVHGEDEALEGIRERLSTFLPQDHLIRPRLDSAFRLGSHGAVQISEAVAPP
RIDPVRVGRTDWHNDIQKLVLDLQDELAKAADDKARGVVIRRLRRALQEEA