Protein Info for SMa1115 in Sinorhizobium meliloti 1021

Annotation: Mn2+/Fe2+ transporter NRAMP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 65 to 84 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 310 to 336 (27 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details PF01566: Nramp" amino acids 52 to 417 (366 residues), 266.1 bits, see alignment E=2.5e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1115)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z88 at UniProt or InterPro

Protein Sequence (442 amino acids)

>SMa1115 Mn2+/Fe2+ transporter NRAMP family (Sinorhizobium meliloti 1021)
MRRKSWHVDNDDRVQSGLLAKPVVYRLRRAALLDKLGPGLITGAADDDPSGIATYSQAGA
QFGANMLWMMFFLYPLMCTMQMISARIGRVSGHGLAANMRRIFPSWVVTSLVALLFIANT
INIGADLAAMGAAAELVLGWGRHLFTLVFAVASLTVQVLVPYHRYVLYLKWLTLVLFAYV
GVVFTIEIDWSETALRMVTPQLALTRETAIMVVAVFGTTISPYLLFWQASEEVEDDEADP
TTDPLIDHPEQALVQLSRIRWDTYIGMAFANLVAFFIILTTALTLHAAGVTEIETSADAA
EALRPIAGDLAFALFSLGIIGTGLLAVPILAGSAAYAVCESRGWPIGLEHKPREAVGFYT
VIGLATLIGLAVDYSDLDPIRALFWSAVLNGVVSVPLMAAMMIVVSRKDEMGQFVASFRL
RVMGWFATACMAAAAITMFILS