Protein Info for SMa1079 in Sinorhizobium meliloti 1021

Annotation: TspO/MBR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details PF03073: TspO_MBR" amino acids 31 to 168 (138 residues), 164.8 bits, see alignment E=5.5e-53

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 100% identity to sme:SMa1079)

Predicted SEED Role

"TspO and MBR like proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZA7 at UniProt or InterPro

Protein Sequence (180 amino acids)

>SMa1079 TspO/MBR family protein (Sinorhizobium meliloti 1021)
MEGLACLAGGSLHLLQMDMHSLLVLVAFEVASFAAAATGVIFRPGDWYKQLNKPRWRPPD
WLFAPVWAVLYASIGLSGWLVWQEAGIAGAALPLGTYAVQLLLNAAWTPIFFGLHRPGLA
AVEIMVLWAAILATTVMFHPVNAAAALLLVPYLAWVSFAAALNLSIWRRNRSKTLSQSTR