Protein Info for SMa1077 in Sinorhizobium meliloti 1021

Annotation: Nex18 symbiotically induced protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02469: Fasciclin
  • amino acids 35 to 157 (123 residues), 141.7 bits, E=7.1e-46

Best Hits

Swiss-Prot: 50% identical to Y175_SYNP2: Uncharacterized protein SYNPCC7002_A0175 (SYNPCC7002_A0175) from Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)

KEGG orthology group: None (inferred from 100% identity to sme:SMa1077)

MetaCyc: 44% identical to CO2 hydration protein CupS (Synechococcus elongatus PCC 7942 = FACHB-805)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Sensory subunit of low CO2-induced protein complex, putative" in subsystem CO2 uptake, carboxysome

MetaCyc Pathways

• cyanate degradation (2/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See Q92ZA8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>SMa1077 Nex18 symbiotically induced protein (Sinorhizobium meliloti 1021)
MKLNSLLFAAAITLGSVSAFAADKDVVDTAMEAGQFKTLGAALEAAGLIATLKETGPFTV
FAPTDEAFAKLPAGTVENLLKPENKQKLTEILTYHVVAGRVMAADVAGIDEAKSVNGKMI
DIEVEGSTVKVNDAAVTAADIAASNGVIHVIDKVIMPPEG