Protein Info for SMa1050 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 7 to 38 (32 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details PF01925: TauE" amino acids 10 to 113 (104 residues), 63.2 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to sme:SMa1050)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZC2 at UniProt or InterPro

Protein Sequence (181 amino acids)

>SMa1050 hypothetical protein (Sinorhizobium meliloti 1021)
MSTSILAAVGSGGIVGFMLGLLGGGGSILATPLLLYVVGVTQPHVAIGTGALAVSVNAFA
NFASHAIKGHVWWRCAAVFSALGVLGALGGSSLGKAMDGDRLIFLFGILMVVVIGGGIVG
GVLGMLLATRLSAYKNILHRLFAALIFVVAAYILYQSARQAGAHQSLLDPHVVFDGAHAP
S