Protein Info for SMa1041 in Sinorhizobium meliloti 1021

Annotation: copper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13473: Cupredoxin_1" amino acids 48 to 113 (66 residues), 28.7 bits, see alignment E=1.7e-10 PF06525: SoxE" amino acids 59 to 168 (110 residues), 21.2 bits, see alignment E=2.6e-08 PF00127: Copper-bind" amino acids 63 to 167 (105 residues), 41.6 bits, see alignment E=2.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1041)

Predicted SEED Role

"Copper tolerance protein" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZC6 at UniProt or InterPro

Protein Sequence (170 amino acids)

>SMa1041 copper oxidase (Sinorhizobium meliloti 1021)
MPMFNQPKDHTMKALIFGLLVAAHASPALAAGSHAGGHGEAMVVGEPGKKAQATQTIQVT
MKETDDGKMIFTPSTFNVSKGQTIRFAIKNAGELDHEFVLDQEDKIMEHKAVMEKFPDME
HDDPNAIRLAAGESGEIVWKFTNDGTFKIACLVPGHYDAGMHGDVTVAKK