Protein Info for SMa1016 in Sinorhizobium meliloti 1021

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 48 to 64 (17 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 46 to 393 (348 residues), 71.3 bits, see alignment E=7.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1016)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZD8 at UniProt or InterPro

Protein Sequence (424 amino acids)

>SMa1016 acyltransferase (Sinorhizobium meliloti 1021)
MPKSLLAQPQIVTVNTTVASYSPYFPTGQSLSAGTIEKVQSRALGPDVLRSLAILLVILV
HLPVEATPPSLVGHAWLGVDVFFVLSGFLIGTQLFREVARTGRVDLKSFYLRRAFRIFPA
FFVVLGLYAIFPVIWDASTMQSVWSFATFTVNFDFDPRVGRAFSQAWSLCVEEHFYLVLP
LLVLILHRRISMGSTLLIAGAMVGGGMALRYTIWESQVGVLVAADKLGDAFAVYLRDVYY
PTYTRLDGLIFGVILAAARFFKPELCKRYAPPRIALPIGFALVAAALVLFSIRGPLAGTN
LFLVFQAQVGSVAGFPLISIGIALILGAMLDVEHILRRWPFPGAATVATLSYSLYLTHKS
VFHIDRLVFGEGNLQGGFGFAVYLATSFAAATMLWFCVERTFLLLRDRVLSPKRPLAKEG
AHRF