Protein Info for SMa0876 in Sinorhizobium meliloti 1021

Annotation: NolF secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 363 (318 residues), 215.8 bits, see alignment E=3.8e-68 PF25954: Beta-barrel_RND_2" amino acids 216 to 283 (68 residues), 54.6 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 100% identical to NOLF_RHIME: Nodulation protein NolF (nolF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0876)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25196 at UniProt or InterPro

Protein Sequence (367 amino acids)

>SMa0876 NolF secretion protein (Sinorhizobium meliloti 1021)
MTISAQCNLQKLAFATTLAVTIVLSQGRAIGQVKHGSPIELAKADVSTAVRQDMANEVRI
VGSLTPIRRSTLTSRVSSTIIELPVQIGDVVNAGDLLVRFERGALESAVTGRKAEADALS
AQTELAEAVLERNTRLGERGAASEATRLAALADVLDLRAQLRSKQAEVSDAERSLSHAEV
RAEFGGVIAARSVEEGQTVPLNTQLMTIVELNRLEVDAGVPTSRIPLIRLKQSVELTVEG
FPGRTFSGEVARISPTADAGSRAVRVFIAVDNEEGLLRGGMFTIGDLRVDDQKDVIALPA
ASIRHDADGFFVLKVEAGVLQRRPVGLGRSWSDRDLVQVSGVSEGDVIVTAPLPDLVVNT
PVIIEGI