Protein Info for SMa0868 in Sinorhizobium meliloti 1021

Annotation: NodB chitooligosaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01522: Polysacc_deac_1" amino acids 17 to 139 (123 residues), 141.7 bits, see alignment E=5.8e-46 TIGR04243: chitooligosaccharide deacetylase NodB" amino acids 21 to 214 (194 residues), 328.9 bits, see alignment E=4.6e-103

Best Hits

Swiss-Prot: 100% identical to NODB_RHIME: Chitooligosaccharide deacetylase (nodB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_6325)

Predicted SEED Role

"Nodulation protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P02963 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SMa0868 NodB chitooligosaccharide deacetylase (Sinorhizobium meliloti 1021)
MKHLDYIHEVPSNCDYGTEDRSIYLTFDDGPNPHCTPEILDVLAEYGVPATFFVIGTYAK
SQPELIRRIVAEGHEVANHTMTHPDLSTCGPHEVEREIVEASEAIIAACPQAAVRHIRAP
YGVWSEEALTRSASAGLTAIHWSADPRDWSRPGANAIVDAVLDSVRPGAIVLLHDGCPPD
ESGALTGLRDQTLMALSRIVPALHERGFAIRPLPPHH