Protein Info for SMa0849 in Sinorhizobium meliloti 1021

Annotation: SyrM transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 248 to 269 (22 residues), see Phobius details PF00126: HTH_1" amino acids 34 to 93 (60 residues), 46.3 bits, see alignment E=3.3e-16 PF03466: LysR_substrate" amino acids 122 to 321 (200 residues), 74 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 100% identical to SYRM_RHIME: HTH-type transcriptional regulator SyrM (syrM) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0849)

Predicted SEED Role

"SyrM transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18561 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SMa0849 SyrM transcriptional regulator (Sinorhizobium meliloti 1021)
MDQPTWKRPHRAKFAGVSDAAQQRQMPNLASIDLNLLVDLEALLQYRHITQAAQHVGRSQ
PAMSRALSRLRGMLKDDLLVAGSRGLVLTPLAECLTQMLPSVLDAIRQMMNLSLAPAQRR
WKVTMAMPDHQAVVLLPHLLPRLHERAPHLDIVTDPLLGGALGLLEQGEIDVVVGQMGAA
PLGYLRRRLYADSFTCVLRHNHPALAQEWTIEAFAALRHVAIASEPDELFGQIYDRLTKL
GLQRGDPMVVSTVLTAAVLIAATDSVLVVPSRVATRVAAMLSLAVIPPPVELRPYEVALI
WHERCHRDPEHRWLRGEIAAAASTAG