Protein Info for SMa0834 in Sinorhizobium meliloti 1021

Annotation: FdxB ferredoxin III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR02936: ferredoxin III, nif-specific" amino acids 5 to 98 (94 residues), 135.4 bits, see alignment E=2.8e-44 PF13237: Fer4_10" amino acids 21 to 91 (71 residues), 32.7 bits, see alignment E=3.4e-11 PF13183: Fer4_8" amino acids 25 to 93 (69 residues), 30.7 bits, see alignment E=2.2e-10 PF12838: Fer4_7" amino acids 25 to 94 (70 residues), 40.1 bits, see alignment E=2.6e-13 PF13187: Fer4_9" amino acids 26 to 93 (68 residues), 29.5 bits, see alignment E=3.7e-10 PF12797: Fer4_2" amino acids 73 to 91 (19 residues), 24.6 bits, see alignment 1.1e-08 PF00037: Fer4" amino acids 77 to 94 (18 residues), 27 bits, see alignment 1.7e-09

Best Hits

Swiss-Prot: 79% identical to FER3_SINFN: Putative ferredoxin-3 (fdxB) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 99% identity to smd:Smed_6219)

Predicted SEED Role

"4Fe-4S ferredoxin, nitrogenase-associated" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZK9 at UniProt or InterPro

Protein Sequence (105 amino acids)

>SMa0834 FdxB ferredoxin III (Sinorhizobium meliloti 1021)
MISSFVTRDGSRWMPKYLSAIDGATCIGCGRCFKVCSREVMHLHGIDDVGEILGPFDGEE
DDFGGELNRMIMVVDSRGRCIGCGACARVCPRDCQTHVAADILAA