Protein Info for SMa0830 in Sinorhizobium meliloti 1021

Annotation: nitrogenase molybdenum-cofactor biosynthesis protein NifE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR01283: nitrogenase MoFe cofactor biosynthesis protein NifE" amino acids 9 to 459 (451 residues), 631 bits, see alignment E=5e-194 PF00148: Oxidored_nitro" amino acids 45 to 442 (398 residues), 330.9 bits, see alignment E=5.3e-103

Best Hits

Swiss-Prot: 100% identical to NIFE_RHIME: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (nifE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02587, nitrogenase molybdenum-cofactor synthesis protein NifE (inferred from 100% identity to sme:SMa0830)

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifE" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZL2 at UniProt or InterPro

Protein Sequence (476 amino acids)

>SMa0830 nitrogenase molybdenum-cofactor biosynthesis protein NifE (Sinorhizobium meliloti 1021)
MPSLSAKNQAFFNEPACERNRSKDFKVRKKGCSQPPMPGAAAGGCAFDGAKVALQPITNV
AHLIHAPLACEGNSWDNRGTASSSHMLWRTSFTTDVTEFDVVMGHSERKLFKAIREINEA
YAPAAVFVYATCVTALIGDDIDAVCRRAAEKFGLPVVPVNAPGFVGSKNLGNKLAGEALL
DHVIGTVEPDDARSSDINILGEFNLSGEFWQVRPLLDKLGVRVRACIPGDSRYLDIATAH
RARAAMMVCSTALINLARKMLERWDIPFFEGSFYGITDTSEALRQIAGLLVKQGAGPDLI
SRTEALIVEEEARAWRRLEVYRPRLQGKRVLLNTGGVKSWSVAHALMEIGLEIVGTSIKK
STDNDKERLKQMLTNDSRMSGATTPRELYSALSDHKADIMLSGGRTQFIALKAKMPWLDI
NQERQHSYAGYHGVVELARQIDLSIHNPIWAQVREAAPWEMAPARGEEMSEEEALL