Protein Info for SMa0814 in Sinorhizobium meliloti 1021

Annotation: NifB FeMo cofactor biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR01290: nitrogenase cofactor biosynthesis protein NifB" amino acids 43 to 476 (434 residues), 682.7 bits, see alignment E=1e-209 PF04055: Radical_SAM" amino acids 68 to 246 (179 residues), 74.2 bits, see alignment E=1.5e-24 PF02579: Nitro_FeMo-Co" amino acids 380 to 474 (95 residues), 66.1 bits, see alignment E=3e-22

Best Hits

Swiss-Prot: 100% identical to NIFB_RHIME: FeMo cofactor biosynthesis protein NifB (nifB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02585, nitrogen fixation protein NifB (inferred from 100% identity to sme:SMa0814)

Predicted SEED Role

"Nitrogenase FeMo-cofactor synthesis FeS core scaffold and assembly protein NifB" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09824 at UniProt or InterPro

Protein Sequence (490 amino acids)

>SMa0814 NifB FeMo cofactor biosynthesis protein (Sinorhizobium meliloti 1021)
MSTPMILRESRTSTTFSDQLLENAKSVGCSPPSTAPGDIDPGTWDKIKNHPCFSEEAHHY
FARMHVAVAPACNIQCNYCNRKYDCANESRPGVASEKLTPDQAVRKVIAVANEVPQLSVL
GIAGPGDACYDWKKTRATFERVAREIPDIRLCISTNGLSLPDHVDELAEMNVDHVTITIN
MVDPRVGVKIYPWIYYGQRRHTGIDAARILHERQMLGLEMLAERGILTKVNSVMIPGVND
EHLIEVNKVVKGRGALLHNVMPLISNRIHGTYYGLTGQRGPEAFELQALQDRLEGTKLMR
HCRHCRADAIGLLGDDRGHEFTLAEIPDEITYDASKRQAYRQLVARERGDHLVAKNEANR
TVMSVEYGGSLLIAVATKGGGRINEHFGHAKEFHVYTVSQRGIKLAGRRRVEQYCLGGWG
EVATLDHIVVALEGIDILLCVKIGDYPRKQLTQAGLRATEAYGHDYIESALGALYAAEFG
IEPPVKTATA