Protein Info for SMa0806 in Sinorhizobium meliloti 1021

Annotation: SyrB-like regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF01527: HTH_Tnp_1" amino acids 49 to 134 (86 residues), 41.3 bits, see alignment E=7.1e-15

Best Hits

Swiss-Prot: 100% identical to SYRB3_RHIME: Probable transcriptional regulator syrB3 (syrB3) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to sme:SMa0806)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58346 at UniProt or InterPro

Protein Sequence (151 amino acids)

>SMa0806 SyrB-like regulator (Sinorhizobium meliloti 1021)
MVDESNAGPVAPAVVADAEVKAPTGKKRSSSRPQKAPPEPAQPKMPAAKRRGYSEQERSE
KLRLIETKVSEGNTLKDAIKSAGISEQTYYHWKGAAKSAAREDIERTRPLSAGDEFAELV
QLEEENQRLRKQLAEKLRTENTELRKRLGLD