Protein Info for SMa0802 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 264 (181 residues), 55.4 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to smk:Sinme_6367)

Predicted SEED Role

"Putrescine transport system permease protein potI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZM0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>SMa0802 ABC transporter permease (Sinorhizobium meliloti 1021)
MLLNFDRLGWWKLVLIGITLLTTAFLLLPILFIAVLSFGSSQWLIFPPPGWTLRWYQELL
EDPRWLDSAWTSFRIAIIVTVLSVLLGLVTSFGLNRGRFLFREALKALFLTPMILPVVVL
AVALYAFFLQIGLNGTLTGFVISHLVLALPFSILSITNALEGFDKSIEDAAVLCGASPFE
AKIRVTLPAISHGVFSAAIFSFLTSWDEVVVAIFMASPTLQTLPVKVWSTLRQDLTPVVA
AASTLLILLTVLLMVLVAIVRKGLKS