Protein Info for SMa0752 in Sinorhizobium meliloti 1021

Annotation: dioxygenase reductase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00970: FAD_binding_6" amino acids 22 to 111 (90 residues), 31.9 bits, see alignment E=2.1e-11 PF00175: NAD_binding_1" amino acids 123 to 229 (107 residues), 42.2 bits, see alignment E=1.8e-14 PF00111: Fer2" amino acids 276 to 345 (70 residues), 55.6 bits, see alignment E=6.2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa0752)

MetaCyc: 100% identical to stachydrine N-demethylase reductase subunit (Sinorhizobium meliloti 1021)
R501-RXN [EC: 1.14.13.247]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.247

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZP8 at UniProt or InterPro

Protein Sequence (353 amino acids)

>SMa0752 dioxygenase reductase subunit (Sinorhizobium meliloti 1021)
MTQFKQLSFWSDAEPLECVTRTPEAPNVVTFSFQSPSGALFNHDPGQFVTLELPAPGGPL
YRTYTISSAPSRPTALTITVKAQDGSTGTRWMLDNLHKGMRIRAIGPAGKFSIVHHPADK
YLFISAGSGITPMVAMTTWLYDSGREPDVVFINCARRPSEIILRDRMELMASRIVGIDLK
WVVEEPDPFRSWTGYRGMFNQIMLGLMAQDYLEREVFCCGPEPFMRAVREALAGLGYDMS
RYHQESFTAEPGHAEDVPEDVIPDEQNHAEIAFALSGVTTRCSETDTILAAAKAAGLVIP
SGCSMGICGTCKVRKTEGQVHMVHNGGITDEDVEDGYILACCSKPLRRVSVEA