Protein Info for SMa0748 in Sinorhizobium meliloti 1021

Annotation: MucR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF05443: ROS_MUCR" amino acids 11 to 132 (122 residues), 163 bits, see alignment E=1.5e-52

Best Hits

Swiss-Prot: 78% identical to Y4338_RHIME: Putative MucR family transcriptional regulatory protein RA0938 (RA0938) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0748)

Predicted SEED Role

"putative MucR family transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZQ1 at UniProt or InterPro

Protein Sequence (149 amino acids)

>SMa0748 MucR family transcriptional regulator (Sinorhizobium meliloti 1021)
MTESHSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGKTSEPTKTPATVEEQR
PAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYAR
KRSELARATGLGKKSAANLSPSLQAVRSA