Protein Info for SMa0711 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 69 to 94 (26 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 264 (179 residues), 60.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMa0711)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZS2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SMa0711 ABC transporter permease (Sinorhizobium meliloti 1021)
MQRTTLQTLSLYAGLAVVCGVLLFPIYWLFVTALSTLAEIRQLPPSFWPAEPQWSTFAKV
GTERPIFLWLWNSTLAALGSVALSMVVSVFAGYSLSRFSVKGGRSLGLFILTAKMLPATL
LVIPLFGIFRSMGLIGSLWSLVLAHATLIIPFTTWMLKGYFDTIPRELEQAAMVDGCSPL
GALFRVVLPVATPGLAATALYAFVLSWADYAYARTFLTNAQGSWTANLGITTMKGEYVTD
WNEISAAAVFIALPIILIYLFLERYLVGGLTAGAEK