Protein Info for SMa0697 in Sinorhizobium meliloti 1021

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00746: carbamate kinase" amino acids 1 to 302 (302 residues), 375.3 bits, see alignment E=9.8e-117 PF00696: AA_kinase" amino acids 1 to 278 (278 residues), 70.4 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 100% identical to ARCC_RHIME: Carbamate kinase (arcC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 100% identity to sme:SMa0697)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZT0 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SMa0697 carbamate kinase (Sinorhizobium meliloti 1021)
MRVVIALGGNALLKRGEPMTAEVQRQNIKIAAEAIAPIAAEHQIVVTHGNGPQVGLLALQ
GSAYKPEEAYPLDILGAETEGMIGYMLEQELGNVLPFEVPLATILTMVEVDGNDPGFQNP
TKFVGPVYDASEAGELHQQKGWVFKQDGNKWRRVVASPIPRRIFELRPIQWLLDKGAVVI
CAGGGGIPTMYERGKERTLIGVEAVIDKDLCSALLARDIEADLLILATDAEAVFTGWGTP
ERKAIFKTNPRRLGEFSFPAGSMGPKVEAACHFVNATGRVAAIGALADIPAMVRAERGTI
ISSSFSDITWHVEVPIPGPASRPV