Protein Info for SMa0693 in Sinorhizobium meliloti 1021

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01078: arginine deiminase" amino acids 6 to 407 (402 residues), 497.9 bits, see alignment E=9.8e-154 PF02274: ADI" amino acids 35 to 405 (371 residues), 428 bits, see alignment E=1.8e-132

Best Hits

Swiss-Prot: 100% identical to ARCA1_RHIME: Arginine deiminase 1 (arcA1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 100% identity to sme:SMa0693)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.6

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZT2 at UniProt or InterPro

Protein Sequence (409 amino acids)

>SMa0693 arginine deiminase (Sinorhizobium meliloti 1021)
MRTVGVHSEVGKLRTVMVCRPSLAHQRLTPGNCHDLLFDDVIWVHEAQKDHYDFVLKMEE
RGVEVLELHDLLSDTLIDAEARKFVLDRRVAPNVMGSQIAELMRPWMEEMDSRRLAAFLI
GGISIADLPEGQGKALMASAFHSTQFVLPPIPNTLFQRDPSCWIYNGVTCNPMFWPARRA
ETLIQRAVYKFHPSFKGAAFDIWWGDSDEQFANATMEGGDVMPIGDGILLVGMGERTTYQ
AVGQVAKALFKAGAATRVIGCLMPKSRAAMHLDTVFTFCDRDVVTLFADVVDQIRCYSLF
PLDDEGNFEVRQEDRPMLEVVAEALGVDKLRTIATGGNTYEAEREQWDDGNNVVALEPGV
VVAYDRNTYTNTLLRKAGIEVITIRGSELGRGRGGGHCMTCPIWREPTD