Protein Info for SMa0627 in Sinorhizobium meliloti 1021

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details PF00230: MIP" amino acids 2 to 221 (220 residues), 166.7 bits, see alignment E=3.6e-53 TIGR00861: MIP family channel proteins" amino acids 7 to 221 (215 residues), 185.3 bits, see alignment E=7.1e-59

Best Hits

Swiss-Prot: 100% identical to AQPZ2_RHIME: Aquaporin Z 2 (aqpZ2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06188, aquaporin Z (inferred from 100% identity to sme:SMa0627)

MetaCyc: 65% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZW9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SMa0627 aquaporin Z (Sinorhizobium meliloti 1021)
MFKKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFGLTVLTMAYTVGGISGG
HFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVIATGKADFQLGSFAANGYG
EHSPGGYSLTAALVTEVVMTFFFLIIILGSTHRRVPAGFAPIAIGLALTLIHLVSIPVTN
TSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIAGIVWKSVGEEFRPVD