Protein Info for SMa0585 in Sinorhizobium meliloti 1021

Annotation: nitrate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13379: NMT1_2" amino acids 41 to 300 (260 residues), 351.5 bits, see alignment E=3.5e-109 PF09084: NMT1" amino acids 176 to 287 (112 residues), 21.3 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 63% identical to NRTA_SYNY3: Nitrate/nitrite binding protein NrtA (nrtA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to sme:SMa0585)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZZ1 at UniProt or InterPro

Protein Sequence (430 amino acids)

>SMa0585 nitrate ABC transporter substrate-binding protein (Sinorhizobium meliloti 1021)
MTKTLFGGLTRRSVLKTTATAAMVGAARTLLPSGAFAQGAGPETAKATLGFIALTDSAPL
IIAKEKGLFDKYGMTEVEVVKQASWGTTRDNLVLGSAGAGIDGAHILTPMPYLISTGKVT
QNNQPLPMAILARLNLDAQAISVGAAYADLKVGIDASVLKDAFAKKKAGGEAAKVAMTFP
GGTHDLWIRYWLAAAGIDPDKDVETIVVPPPQMVANMKVGTMDCFCVGEPWNEQLVNQKI
GYTAVNTAEIWAEHPEKSFAMRADWVEKNPRAVKALVMAIEEAAQWCDDMANKDELAKIV
GKRSWFNVPPKDIVDRLKGEYDYGNGKIVENSPHFMKFWREHASYPFQSHDAWFLTENIR
WGKLASDTDIKGLIAKVNREDIWREAAKDLGISDIPASTSRGPETFFDGKVFDPANPETY
LKSLAISRIA