Protein Info for SMa0583 in Sinorhizobium meliloti 1021

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 86 to 286 (201 residues), 322.9 bits, see alignment E=3.9e-101 PF00528: BPD_transp_1" amino acids 121 to 291 (171 residues), 98.2 bits, see alignment E=2.5e-32

Best Hits

Swiss-Prot: 61% identical to NRTB_PHOLA: Nitrate import permease protein NrtB (nrtB) from Phormidium laminosum

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to sme:SMa0583)

Predicted SEED Role

"Bicarbonate transport system permease protein" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZZ2 at UniProt or InterPro

Protein Sequence (297 amino acids)

>SMa0583 nitrate ABC transporter permease (Sinorhizobium meliloti 1021)
MSVTNLKLKPQATPQTAAQVIALGQTASRGIDGRLSRFVTQTVTNLLPLLVTLTFFTLAW
QLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWHVFASLQRVALGYAMAAAV
GVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGTPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVAKVLRLNSFEYFGKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALVGRAVTRGTANA