Protein Info for SMa0581 in Sinorhizobium meliloti 1021

Annotation: nitrate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 25 to 255 (231 residues), 343.7 bits, see alignment E=2.5e-107 PF00005: ABC_tran" amino acids 25 to 167 (143 residues), 120.2 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 62% identical to NASD_KLEOX: Nitrate transport protein NasD (nasD) from Klebsiella oxytoca

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to sme:SMa0581)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZZ3 at UniProt or InterPro

Protein Sequence (266 amino acids)

>SMa0581 nitrate ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTKSYLSLELLDKSFERGGTRTEVLKQVSLTVDKGEFISIIGHSGCGKSTLLNIVGGLTQ
ATTGVVLLDGKVVDEPGPDRAVVFQNHSLLPWLTVYENVRLAVDKVFSRTRNKQERHEWT
MRNLELVQMAHAAEKHPSEVSGGMKQRVGIARALAMEPKVLLLDEPFGALDALTRAHLQD
QVMQIHATLGNTVLMITHDVDEAVLLSDRIVMMTNGPSARVGEILDVPLARPRRRIELAS
DRTYLTCRESVLKFLYERHRFVEAAE