Protein Info for SMa0493 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 163 to 177 (15 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 19 to 118 (100 residues), 45.6 bits, see alignment E=4.2e-16 PF00528: BPD_transp_1" amino acids 31 to 220 (190 residues), 67.5 bits, see alignment E=6.5e-23

Best Hits

Swiss-Prot: 39% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to sme:SMa0493)

Predicted SEED Role

"ABC-type histidine/lysine/arginine/ornithine transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930D9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SMa0493 ABC transporter permease (Sinorhizobium meliloti 1021)
MEALNGWWDDYLLASVTVAKVFVCSLILMVIFGLLGASAKLSSNRLANAVGNAYTVFFRG
TPEILVILLLYFGSAVSLTTIARVFDPSVAFVDIPPFWAGSIAIALVVGSYATETFRGAF
NGVKSGSIEAARALGMNGLQTFFYIRIPEMWRIALPPFGNHMLSLIKDTALISIIGLNET
LFVAKQAASTTGKPFTMYIVVGLIYLGFSTAITISVLLLEALANRHIQRRPS