Protein Info for SMa0469 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 116 to 141 (26 residues), see Phobius details amino acids 180 to 209 (30 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 263 (178 residues), 104.5 bits, see alignment E=2.9e-34

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SMa0469)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930F3 at UniProt or InterPro

Protein Sequence (265 amino acids)

>SMa0469 ABC transporter permease (Sinorhizobium meliloti 1021)
MPVPVVVLFAALIIAAVVICAVLGERIAPDSPFLQRLGVGDTPPSQDHIAGTDLLGRDVL
SRVIYGARTALAGPVVVAAGAFAISTLLGLLSGYLGGLVDSAIMRWVDFMFALPGPLVAI
VVVGVVGGGYWTAVLVLVVLFTAPDTRIVRSAVLEQRPLAYIDAARTLGISKTRILFVHI
LPNIAPIILAYVVLDFAFALVNLAGLSFLGLGVEPGTPDWGRMLFENRTILFSNPAALLL
PAGMIILTAVSMNLVGDWLFERFSK