Protein Info for SMa0394 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 283 to 308 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 115 to 298 (184 residues), 35.7 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to smd:Smed_6312)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930I6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMa0394 ABC transporter permease (Sinorhizobium meliloti 1021)
MRAPRAAYPLTWRVMDVLERLAAIVWPSSFQRGLPYLMLMPALVLVGLLVLGLVQIGDTS
LRTLDTNTFLMSESYTLANYQRVLTESFFATVAGRSLVGSVIVTVITLLLAFPYAYLMVR
TPSSALRKFLLVALFLPFFIGQVVRAYGWLIILGNQGMVNEALGLVGVPPIRLLYNYPAV
LFGLVQYMLPFAVLMLAPALTAIPSELEAAAASLGAGWTRTFRHIVLPLSRPGLVGAGLV
VLTLSLTDFAIPAILGGGTQDFIANAIYDQFFRTSDQGMGATLSLMLVAVGSMLVGVVFM
LFGAGTLAMTGDRK