Protein Info for SMa0340 in Sinorhizobium meliloti 1021

Annotation: TrpR binding protein WrbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01755: NAD(P)H:quinone oxidoreductase, type IV
  • amino acids 3 to 196 (194 residues), 309.9 bits, E=4.2e-97
• PF03358: FMN_red
  • amino acids 3 to 142 (140 residues), 46.9 bits, E=3.4e-16
• PF00258: Flavodoxin_1
  • amino acids 6 to 124 (119 residues), 41.6 bits, E=2.2e-14

Best Hits

Swiss-Prot: 100% identical to NQOR2_RHIME: NAD(P)H dehydrogenase (quinone) 2 (RA0183) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to smk:Sinme_6597)

MetaCyc: 63% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

See Q930L2 at UniProt or InterPro

Protein Sequence (202 amino acids)

>SMa0340 TrpR binding protein WrbA (Sinorhizobium meliloti 1021)
MTRVLVLYYSSYGHIETMAGAVAEGARSTGAEVTIKRVPETVPIEVADKAHFKLNQAAPV
ATVAELADYDAIIVGTGTRFGRMSSQMAVFLDQAGGLWARGALNGKVGGAFVSTGTQHGG
QETTLFSIITNLMHFGMVIVGLPYSHQGQMSVDEIVGGAPYGATTVAGGDGSRQPSQIDL
AGAFHQGEIVARTAAALVAARN