Protein Info for SMa0300 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 162 (30 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 4 to 77 (74 residues), 43.8 bits, see alignment E=2.7e-15 PF00528: BPD_transp_1" amino acids 119 to 314 (196 residues), 125.7 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 35% identical to GSIC_PECAS: Glutathione transport system permease protein GsiC (gsiC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_5281)

Predicted SEED Role

"ABC transporter, permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930N4 at UniProt or InterPro

Protein Sequence (317 amino acids)

>SMa0300 ABC transporter permease (Sinorhizobium meliloti 1021)
MSVLRLLASRILFSVLTLLLVSVLIFLILEALPGDVATRILGRDATAKALELLRSQLDLD
QPALVRYFQWLGDFLRGDLGVSIATGRPITDVLGPRIVNTLLLSLFAFAIYLVLALVPAI
IQATNRGKAVDNIISVITLVLLSLPDFLLATILLFLFAVAVPILPALATISEASTWQETL
RAMVLPAVTLAIMMAVYAIRVLRDSLIEVLRSDYVRLAELKGLRPTAVLFRHALPNAIVP
ALNVTALNFGFLIGGVVIVERVFSYPGFGTLLIDALQLRDIPLIKATVMISAVVYVAANL
VADVLAVLLQPRLRTSR