Protein Info for SMa0271 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 322 (276 residues), 138.3 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to smk:Sinme_5350)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930Q1 at UniProt or InterPro

Protein Sequence (331 amino acids)

>SMa0271 ABC transporter permease (Sinorhizobium meliloti 1021)
MTVATATLAPTNEGARIRWADLAPFIALAVIVLFGALVNPNFVSSANLINVITRSAFIAI
IAVGATFVISSGGLDLSVGSMMAFVTGIMIMAMNHLAPAFGAWAIPMGAGVALLVGALCG
LFNGLIVTVGRIEPFIVTLGTMGIFRAFITFMTDGGSLPIDRSLREAYRPVYFGSFFGIP
YPVLITFVVVMAGAFLLYKTKYGRRLKSAGSNVEVARFSGVNVAGVRTGAYVIQGFCVAV
AAICYVPRLGAATPTTGQLWELQVITAVVIGGTLLRGGRGRIGGTVAGALILEVIANVMV
LSDLVSEYLVAAVQGAIIIIAMLAHRFTANR