Protein Info for SMa0247 in Sinorhizobium meliloti 1021

Updated annotation (from data): 2-dehydro-3-deoxy-D-arabinonate dehydratase, 2,4-dioxopentanoate forming
Rationale: Specifically important in carbon source D-Arabinose. SMa0247 is related to 2-keto-3-deoxyxylonate dehydratase (xylX), which acts on the same substrate. Furthermore, a close homolog (HSERO_RS19360, 59% identical) is important for D-xylose utilization. However, the product of XylX is 2,5-dioxopentanoate, but in S. meliloti the pathway probably proceeds via 2,4-dioxopentanoate (see SM_b21112).
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF01557: FAA_hydrolase" amino acids 225 to 366 (142 residues), 31.5 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa0247)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930R4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>SMa0247 2-dehydro-3-deoxy-D-arabinonate dehydratase, 2,4-dioxopentanoate forming (Sinorhizobium meliloti 1021)
MSGGFLVSFEQALSAESIQPADASSAMLVGRVWSKTAGGPCPVLISEGEVFDLTPLAATI
SALLEIDGLVDALRDPSRFASLGSLDAFLRGEAGDLLAPADLQAVKAAGVTFADSMLERV
IEEQAKGDPLRAQEIRGRLAPVLGDNLKGLVAGSDKAAEVKKLLQELGLWSQYLEVGIGP
DAEIFTKAQPMSSVGCGAYIGIHPKSDWNNPEPEVVLAVTSKGKIVGATLGNDVNLRDFE
GRSALLLSKAKDNNASCSIGPFIRLFDGAFTIEDVKQAEVSLVVDGKEGFKMTGISPMSA
ISRSPEDLVSQLLNDNHQYPDGVVFFLGTMFAPVKDRRGTGLGFTHEIGDRVEISTPRLG
RLVNWVDHSDRCPKWSFGLGALMKNLAERGLLQAKREG