Protein Info for SMa0241 in Sinorhizobium meliloti 1021

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF04321: RmlD_sub_bind" amino acids 1 to 163 (163 residues), 33.2 bits, see alignment E=6e-12 PF01370: Epimerase" amino acids 3 to 208 (206 residues), 75.4 bits, see alignment E=9.6e-25 PF01073: 3Beta_HSD" amino acids 4 to 185 (182 residues), 43.9 bits, see alignment E=3.3e-15 PF16363: GDP_Man_Dehyd" amino acids 4 to 167 (164 residues), 42.9 bits, see alignment E=9.2e-15

Best Hits

Swiss-Prot: 49% identical to DEND_CUPNH: D-erythronate dehydrogenase (denD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0241)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930R7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SMa0241 epimerase (Sinorhizobium meliloti 1021)
MHILIIGAAGMVGRKLTQRLVKDGTLGANSVEKLTLVDVVAPERPQGFAGTVVAREGDLS
ASGEAEKLVEGRPDVIFHLAAIVSGEAELDFDKGYRINLDGTRYLFDAIRLAHDQDGYKP
RLVFTSSIAVVGAPLPFPIPDDYHLTPLTSYGTQKAICELLLSDYSRRGFFDGIGIRLPT
ICIRPGKPNKAASGFFSNILREPLVGQEAVLPVSEDVRHWHTSPRSAVGFLIHGATINLE
KVGPRRNLSMPGLSATVGEQIEALRRVAGEKAVQLIRREPDEMIMKMVAGWAPGFEAKRA
TELGFTAEKSFDEIIRVHIEDELGGKL