Protein Info for SMa0217 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 117 to 148 (32 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 86 to 346 (261 residues), 142.1 bits, see alignment E=9.4e-46

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa0217)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930T0 at UniProt or InterPro

Protein Sequence (359 amino acids)

>SMa0217 ABC transporter permease (Sinorhizobium meliloti 1021)
MGARRRARPVPRSPTIECQTVTPVLAESAAPRSRTQRQSILKQIMGMPAGAIFLVFMTLQ
IVCIAGALLYPDEFRYLSPQNLTILMKAIPVLGCLALGAGVLMIAGEFDLSIGSVYTFTA
VLMASLVNAGLSAFIAAPIAILTGLLIGSLNGHITLRFGLPSFIVTLGGLLFWRGAVLLY
NGAVQVRFDPEPVFTSLFSGTLFGVNAAFIWIVLFVTGFHLLLHRHRFGNHVFATGGNRG
AAEAIGINTSRVKLIAFAIAGGMAAVAGILATARVGSVQPGQGAGLELQAIAACVIGGLS
LRGGRGSIIGIFLGVLLIHTITDVLLLLRAPGFYLDMFIATLIVLAAIFNHLIERRGLA