Protein Info for SMa0169 in Sinorhizobium meliloti 1021

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF13489: Methyltransf_23" amino acids 17 to 145 (129 residues), 54.1 bits, see alignment E=7.1e-18 PF05175: MTS" amino acids 29 to 102 (74 residues), 26.3 bits, see alignment E=2.2e-09 PF01135: PCMT" amino acids 29 to 92 (64 residues), 24.9 bits, see alignment E=7.5e-09 PF13847: Methyltransf_31" amino acids 29 to 130 (102 residues), 75.1 bits, see alignment E=2.4e-24 PF01209: Ubie_methyltran" amino acids 30 to 133 (104 residues), 50.2 bits, see alignment E=1e-16 PF02390: Methyltransf_4" amino acids 32 to 88 (57 residues), 31.8 bits, see alignment E=4.3e-11 PF13649: Methyltransf_25" amino acids 32 to 126 (95 residues), 81 bits, see alignment E=3.8e-26 PF08241: Methyltransf_11" amino acids 33 to 130 (98 residues), 74.9 bits, see alignment E=2.9e-24 PF08242: Methyltransf_12" amino acids 33 to 129 (97 residues), 60.5 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa0169)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930V4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SMa0169 methyltransferase (Sinorhizobium meliloti 1021)
MALDRADFYDAELARHNRQLRVAADFGADDRVLDIGCGAGQTTREAARAAPQGEAIGVDI
SAEMLEEARRRSAAEGLRNAMFEQGDAQFHGFPTGSFDLCISRFGVMFFADPAAAFANIG
RAMRPGARLVWMVWQSRERNEWSRAIRQALAPAIAVSAGAANPFSLGDPPVATDLLSAAG
FTSIDFADVQEPVFYGSDVDAAFDALTSLYLVQDALASTNEPPDKPLQRLRDLLEGHMTP
EGVFFDSRAWIITARRAGGGG