Protein Info for SMa0136 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 278 to 308 (31 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 348 to 379 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 40 to 378 (339 residues), 169.2 bits, see alignment E=6.8e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5428)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930X3 at UniProt or InterPro

Protein Sequence (670 amino acids)

>SMa0136 hypothetical protein (Sinorhizobium meliloti 1021)
MLKFSRGIDQDRAATAGGLQQIAFARGSAAAAQPSRLPTLVATAAAVAVLYFARDVFLPL
AIAILLTFALAPLVSRLRRVGCPRSVAVIGTVTTAFLFLSAFGVVIAMQVSEVAQNLPTY
QYNIVEKVRTLKETGSESQILERIGRVIERISTEISRPEPEVRASPEPTPETKPLLVEIF
SPQRPIETLKNIINPLLGPLATTGLVIVVVIFMLLEREELRDRFIRLVGYGDLHRTTEAL
QDAGARVGRYLLMQLVVNITYGIPLAIGLSLLGIPNAVLWGMLAIVLRFVPYIGPVIAAA
LPLFLAFAAAPGWSLLVWTAALFIVLELLSNNVVEPWLYGSRTGLSPLAIIVAAIFWAWL
WGPVGLVLSTPLTVCLVVLGRHVPQFEFLEILLGNEPVLDPKERLYQRLLAGDPDEATDN
AEDMLQEKYLVEFYDTVAIPALLLAERDRARGALTNTQAAQIAQSANTLIANLEEIAGEE
EGEEETSTEAQESDDDNDDAEEYDLPPGDGKSVLCVGGRSDLDDVTASMLAQTLWIQGAD
AAHATHEVLKAGNIKALQLEGRNAVVLSVLDQDFMRHAKFTVRRLKRIAPAARVGIVLWK
EDGRPGTTERDQLIESLQADFVVFGMGDAVREALSDELPRSLKLAHPKIAPGYAMRRSKR
TDTESTVKAD