Protein Info for SMa0130 in Sinorhizobium meliloti 1021

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details PF00487: FA_desaturase" amino acids 61 to 307 (247 residues), 109.4 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: K10255, omega-6 fatty acid desaturase (delta-12 desaturase) [EC: 1.14.19.-] (inferred from 100% identity to smk:Sinme_5432)

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930X6 at UniProt or InterPro

Protein Sequence (355 amino acids)

>SMa0130 fatty acid desaturase (Sinorhizobium meliloti 1021)
MSAHVYPPASLVEDNAGAWLKTLAKYRQPRLGRSAFELFVTLVPFAIFWAAACFSLANGF
WPGLIAILPASAFLLRLFMIQHDCGHGSFFSRRGLDDWTGRLLGVLTLTPYDYWRRAHAA
HHATAGNLDERGVGDITTLTITEYCALSPIKRLGYRLYRHPLVMFGIGPAWLFLFKQRLP
FGMMNSGALPWISTMATNFAIVTLAALMVWAVGLGTFLLIHLPVVLLAGAAGVWLFYVQH
QFEETHWSAGEDWRFPQAALHGASHYDLPPVLRWLTGNIGIHHVHHLSSRIPYYRLPEVL
RDHPQLAGIGRITLWDSLKCVRLVLWDDRRRRLVSFHDAAGSLRRSLTEDGRKTK