Protein Info for SMa0116 in Sinorhizobium meliloti 1021

Annotation: DnaJ/CbpA-type protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00226: DnaJ" amino acids 4 to 66 (63 residues), 78.8 bits, see alignment E=2.6e-26 PF01556: DnaJ_C" amino acids 132 to 275 (144 residues), 141.5 bits, see alignment E=2.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5442)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930Y5 at UniProt or InterPro

Protein Sequence (305 amino acids)

>SMa0116 DnaJ/CbpA-type protein (Sinorhizobium meliloti 1021)
MTDDPYQILGVPRTGKPDEIRKAYRKRAKELHPDLHPGDKEVETKFKALSAAYHLLSDPE
QRARFDRGEIDASGAERPQQHFYRHYADADHARRYGSAGGTGEFEDVSDIFADLFGQGGA
GGRFKARGQDRHYHLELEFLDAVNGARRRITFPDGNTLDLAIPAGTRDGSTLRLRGKGTP
GIAGGEPGDALIEISVRSHSVFRREGNDIEIDLPITLYEAVLGAKIEVPTISGRVSMTIP
KGSNTGDILRLRGKGVKSQHGPAGDQRVTLKVVLPTATDPDLERFMETWRRSHAYDPREA
LGRAT