Protein Info for SMa0083 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00005: ABC_tran" amino acids 36 to 184 (149 residues), 137.7 bits, see alignment E=4e-44

Best Hits

Swiss-Prot: 70% identical to YHDZ_ECOLI: Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ (yhdZ) from Escherichia coli (strain K12)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to sme:SMa0083)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q931A2 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SMa0083 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MNTEREYASPPDSREALDPAVRMEGVNKWYDAFHALKNIDLTVGRGERIVICGPSGSGKS
TLIRCINQLETIHSGRIVVDGHDLTAGGRNVDLVRQETGMVFQQFNLFPHMTVLENCTLA
PMKVRGLAKAEAEETAMKYLKRVRIPEQAVKYPAQLSGGQQQRVAIARALCMNPKIMLFD
EPTSALDPEMVKEVLDTMVDLANEGMTMLCVTHEMGFARSVADRVVFMDRGEVLEIAPPD
AFFGAPQHERTRFFLGQIS