Protein Info for SMa0009 in Sinorhizobium meliloti 1021

Annotation: formate dehydrogenase subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 2 to 305 (304 residues), 513.1 bits, see alignment E=1.6e-158 PF04216: FdhE_N" amino acids 19 to 182 (164 residues), 169.6 bits, see alignment E=1.1e-53 PF24859: FdhE_central" amino acids 186 to 224 (39 residues), 49.6 bits, see alignment 5e-17 PF24860: FdhE_C" amino acids 225 to 303 (79 residues), 101.3 bits, see alignment E=4.3e-33

Best Hits

Swiss-Prot: 100% identical to FDHE_RHIME: Protein FdhE homolog (fdhE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to smk:Sinme_5502)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q931D7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SMa0009 formate dehydrogenase subunit epsilon (Sinorhizobium meliloti 1021)
MSVSPVQPDPSVIGGVPKAPFVLKPNLARLFNDRASRFEALAQGSHLAPYLNFLAGITRI
QSELVSALPPPEPVPADRVERARANAMPPIDRAAMGGSPDCREVLQQFFEKAEALEKPAA
AAEALAQVRTADEEMLTWMIGNVMADDLPVESLAHHLYVAAAMQIQAARLAAGLDGSRLV
PIRVGVCPACGGRPVASMVIGFHGAEGARYASCSCCATMWNEVRVKCLACGSTKGIGYQA
VETGDEEATVKAEVCDTCNSWMKILYQNKNPSLDVVADDVASLGLDLLMKDTEYKRAGFD
PFLMGY