Protein Info for SMa0005 in Sinorhizobium meliloti 1021

Annotation: formate dehydrogenase susbunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 25 to 307 (283 residues), 536.6 bits, E=5.6e-166
• PF12838: Fer4_7
  • amino acids 53 to 131 (79 residues), 33 bits, E=3.4e-11
• PF13247: Fer4_11
  • amino acids 109 to 205 (97 residues), 75.5 bits, E=1.6e-24
• PF13237: Fer4_10
  • amino acids 111 to 161 (51 residues), 25.5 bits, 5.2e-09
• PF00037: Fer4
  • amino acids 146 to 164 (19 residues), 23.2 bits, see alignment (E = 2.3e-08)
• PF09163: Form-deh_trans
  • amino acids 263 to 306 (44 residues), 57.1 bits, 6.2e-19

Best Hits

Swiss-Prot: 61% identical to FDNH_ECOLI: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Escherichia coli (strain K12)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 99% identity to smk:Sinme_5504)

MetaCyc: 61% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See Q931D9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SMa0005 formate dehydrogenase susbunit beta (Sinorhizobium meliloti 1021)
MMDSPRTAVSNPPVQPMESNLTERDLVRRSATTELPPPERQLTPVAKLIDVSKCIGCKAC
QSACVEWNDTHPGIGENVGYYTNPHDLTEDMFTLMRFTEWVNPETDNLEWLIRKDGCMHC
ADPGCLKACPAPGAIVQYTNGIVDFVHENCIGCGYCIKGCPFNIPRISKVDHRAYKCTLC
SDRVAVGQGPACAKACPTQAIVFGTKEDMKKHAEHRIADLKSRGYTNAGLYDPPGVGGTH
VMYVLHHSDKPHIYSDLPDDPKISAVVQAWKGVTKYTGLAAMGLVAAGAILHGVFGRANR
VQPEDEESAERLVDSAGAAGRTPDDKGQRS