Protein Info for SM_b21691 in Sinorhizobium meliloti 1021

Annotation: nitrilotriacetate monooxygenase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 7 to 428 (422 residues), 587.9 bits, see alignment E=5.4e-181 PF00296: Bac_luciferase" amino acids 20 to 379 (360 residues), 159.5 bits, see alignment E=6.6e-51

Best Hits

Swiss-Prot: 55% identical to YXEK_BACSU: Putative monooxygenase YxeK (yxeK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4258)

MetaCyc: 55% identical to N-acetyl-S-(2-succino)-L-cysteine monooxygenase monomer (Bacillus subtilis subtilis 168)
1.14.13.M85 [EC: 1.14.13.M85]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TM7 at UniProt or InterPro

Protein Sequence (449 amino acids)

>SM_b21691 nitrilotriacetate monooxygenase subunit A (Sinorhizobium meliloti 1021)
MTRQIKLGAFLPGGGQHIAAWRHPDAPADGATNFEFHRRLAETAERGLFDAYFLADNLSV
GLGGREGGNAKIAGFEPVTLFAALAPLTTHLGFIATASTTYEEPYTLARKFASLDLLSNG
RAGWNVVTSAGDETARNFNRETQPSHADRYERAHEHVETVKALWDSWEDDAFIRDKATGR
FFDAGRVHDIDHKGKHFSVKGPLNAPRPVQGHPVVVQAGQSEDGRRLAAVSAEVIFTAHQ
NLASAQEFYRDIKARVKRAGRNPEHVLIMPGVAPFVGRTEEEARSKYEELNALIVPEDGV
ALLNGLTGGTLDLTGYPLDGPLPVSNETEGMKSRQALIRKIADEHGFTIRQLYQWIATAR
GHYTVVGSAEQVADQLEEWFLSEAADGFNILPPWLPGALDDFVDLVIPILQRRGLFRTAY
EGRTLRENLGLPRPANPWTLARATVQAAE