Protein Info for SM_b21647 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Raffinose, periplasmic substrate-binding protein
Rationale: Specific phenotype on D-Raffinose pentahydrate.
Original annotation: alpha-galactoside ABC transporter substrate-binding protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00496: SBP_bac_5" amino acids 154 to 556 (403 residues), 220 bits, see alignment E=2.8e-69

Best Hits

Swiss-Prot: 100% identical to AGPA_RHIME: Periplasmic alpha-galactoside-binding protein (agpA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_4178)

Predicted SEED Role

"Periplasmic alpha-galactoside-binding protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9X4Y1 at UniProt or InterPro

Protein Sequence (693 amino acids)

>SM_b21647 ABC transporter for D-Raffinose, periplasmic substrate-binding protein (Sinorhizobium meliloti 1021)
MKTHRLNMTASLLIGISAFAVQAFASEPTVVPEQPPFPAQGKITYVSRDSILEFKALREY
REPEWVTEKFVKAGKLPPVAERLPKEPMVFKAGNMPDGMGVYGDVMRHVIGGRPEGWNYS
AGQTQGWGGIDIGMFECLTRTAPLFQVEADDMEPLPNLAKSWDWSEDGRKLTMHLIEGAK
WSDGDPFDADDVMFYWEDNVLDSSVSPLNGATPETFGEGTTLKKIDQYTVEWTFKEAFPR
QHLFAMAYGTFCPGPSHILKTKHPKYAGTTYNEYKNGFPAEYMNLPVMGAWVPVAYRPDD
IIVLRRNPYYWKVDEAGNQLPYLNELHYKLSTWADRDVQAIAGSGDISNLEQPENFVESL
KRAANESAPARLAFGPRVIGYNMHMNFSGNGWGDPDERAKAVRELNRNLDFRKAVTMAVD
RKKLGEALVKGPFTAIYPGGLSSGTSFYDRNSTIYYPHDLEGAKVLLEKVGLKDTDGNGF
VNFPAGKLGGRDVEIVLLVNSDYSTDRNLAEGMVGQMEKLGLRVVLNALDGKQRDAANYA
GRFDWMIHRNTAEFASVVQNTPQLAPTGPRTSWHHRAPEGGEVDVMPHEQELVDIVNKFI
ASNDNDERTELMKQYQKVATTNVDTVGLTEYPGALIINKRFSNIPPGAPIFMFNWAEDTI
IRERVFVAADKQGDYELYPEQLPGKPGESGPIN