Protein Info for SM_b21646 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Raffinose, permease component 2
Rationale: Specific phenotypes on D-Raffinose pentahydrate.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 112 (112 residues), 47 bits, see alignment E=2.8e-16 PF00528: BPD_transp_1" amino acids 123 to 330 (208 residues), 107.8 bits, see alignment E=5.6e-35

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_4179)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TF5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>SM_b21646 ABC transporter for D-Raffinose, permease component 2 (Sinorhizobium meliloti 1021)
MFRFLLVRIASAIPVLLVLSVVTFGIIQAPPGDYSDYIRSQLINQGGASFEEADAQAQAY
RKEHGLDKPLPIQYVNWITGIVTRGDFGHSLYYNKPVADVVGERLPRTLALALVCHILAS
VIGIAFGIIAATRQYSWIDSLLSTVSFLGMTVPRFLMALIIVYILVFHFNVSEINSFHSA
RYGGAPWSWDKFVDLIKHVWPVVAIATFGGLAYNMRVMRGNLLDTLNAQYVETARAKGLS
EGAVVMRHAVPNALHPLIMYQGVVLPYMLTGEIETAIIFALPTVGPAIVGSMWVGDVYVT
ATFMLVLSATLIVGNIIADMMLAALDPRVRMGGGVYA