Protein Info for SM_b21592 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF00005: ABC_tran" amino acids 20 to 162 (143 residues), 118.4 bits, see alignment E=5.8e-38 PF17912: OB_MalK" amino acids 236 to 286 (51 residues), 45.3 bits, see alignment 2e-15 PF08402: TOBE_2" amino acids 279 to 348 (70 residues), 26.3 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 52% identical to LACK_RHIRD: Lactose transport ATP-binding protein LacK (lacK) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4680)

Predicted SEED Role

"Probable ABC transporter ATP-binding protein y4oS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UR1 at UniProt or InterPro

Protein Sequence (383 amino acids)

>SM_b21592 sugar uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTLQIELNGVNKFYGSYHALKDIDLAIEEGTFVALVGPSGCGKSTLLRSLAGLEKISAGE
MKIAGARMNDVPPRKRDVAMVFQSYALYPHMTVEENLTYSLRIRGVKKAEALKAAAEVAT
TTGLSHLMKRYPRELSGGQRQRVAMSRAIIRHPKAFLFDEPLSNLDAALRVHMRKEIRAL
HDRLGATSVYVTHDQIEAMTMADHVVVMRDGVIEQQGRPLDLYDRPANRFVAGFIGSPAM
NFIPAVVEADGSHLALDLGATRASFSLIDPVRPGASVTVGIRPEHIRIVGAGQGAFDIPV
GVVESTGSATYITSATQPELMVVETGRSAAAGGELIGLAIDPKQLHLFDAETGKRLEPQK
APLDAQITSRAAPHPAAATFSPS