Protein Info for SM_b21542 in Sinorhizobium meliloti 1021

Annotation: iron uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 406 to 431 (26 residues), see Phobius details amino acids 462 to 483 (22 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details amino acids 529 to 553 (25 residues), see Phobius details amino acids 577 to 601 (25 residues), see Phobius details amino acids 605 to 609 (5 residues), see Phobius details amino acids 634 to 660 (27 residues), see Phobius details TIGR03262: putative 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 160 to 669 (510 residues), 785.5 bits, see alignment E=1.4e-240 PF00528: BPD_transp_1" amino acids 198 to 383 (186 residues), 59.2 bits, see alignment E=2.4e-20 amino acids 487 to 658 (172 residues), 31 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to sme:SM_b21542)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UV4 at UniProt or InterPro

Protein Sequence (680 amino acids)

>SM_b21542 iron uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTLAVDFLPPGRAVRQQISGDDWLKRAVMLVVGIYLVVALALPLFVMLSKSFSTYTFDLH
QFEFQVSDQSGQGWSDPVTAAALNAAVAAFPESDLKASADGRLQAAKLFPDFSFRSPVRY
RIRGTSDETHFLAGSQLVRGTEWQEYDSNNFRRVMLRPSRSIGLSNFAEYFSTPSLVRSI
KNSVTMALISTAVTLVVAFGLAYALNRSRMPGKGLFKLIVTIPILVPSLLPGIALVYLFG
NQGVFRDLLLGHSIYGPLGIVVGSVFFTLPHAFLIISTALSVADARHYEAATSLRASKWR
TFWTVTVPGARYGLISAAFVVFTLVITDFGLPKVIGGQYGMLAVDIYKQVIGQQNFEMGA
VVSVILLVPAFLAFAVDRLTQRRQVALLSARAVPYEPKPRRGFDAACFAFCTLVAVFVLG
MIGMCQVAALVKFWPYDLSLSLRNYAFDLMDGGGWDSYYNSIRLALMTAVIGSLIVFTGA
YMVEKTKGFGLGRATFHMLAMLPMAVPGMVLGLAYIFFFNSAANPLHGIYGTMTILVLCT
VTHFYTVAHLTALTALKQLDPEFEAVAGSLKIPFYKLFFRVTLPVCLPAVLEIAIYLFVN
AMTTVSAVVFLYATDTKLASVAILNMDDAGDIAPAAAMGMMIFYTNVAAKLLHAFVSRLL
LARTQGWRRVSQSAAATVPH