Protein Info for SM_b21537 in Sinorhizobium meliloti 1021

Annotation: 2-aminoethylphosphonate--pyruvate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 4 to 360 (357 residues), 482.3 bits, see alignment E=9.5e-149 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 5 to 358 (354 residues), 477.2 bits, see alignment E=4e-147 PF00266: Aminotran_5" amino acids 111 to 291 (181 residues), 41.2 bits, see alignment E=5.4e-15

Best Hits

Swiss-Prot: 100% identical to PHNW_RHIME: 2-aminoethylphosphonate--pyruvate transaminase (phnW) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 100% identity to sme:SM_b21537)

MetaCyc: 50% identical to 2-aminoethylphosphonate aminotransferase monomer (Pseudomonas aeruginosa)
2-aminoethylphosphonate--pyruvate transaminase. [EC: 2.6.1.37]

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UV9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>SM_b21537 2-aminoethylphosphonate--pyruvate transaminase (Sinorhizobium meliloti 1021)
MGEPYLLTPGPLTTAFSVKDAMLRDWGSWDGDFRGMTAELRRELLAIAGDESGQYDCVPM
QGSGSFSVEAMLGSFIPRDGKVLVLMNGAYGQRIAQTLKYLGRAHVSIDKGDYMPPRGSE
VAAALDADPAITHVVVVHCETSSGILNPLKEISEAVYSRGRKLLVDSMSAFGAVPAGVGD
FRYEAIVSSANKCIEGVPGFGFVIARKSELEAAKDRSHSLSLDVHAQWAYMNKTGQWRFT
PPTHVVAAFLEALRLHRKEGGVAGRGARYANNRDVMVAGMRQLGFETLLGDEWLSPIIVT
FFSPAHPNFKFERFYELMKARGFIIYPGKLTVVDSFRIGCIGQMDSHVMQKVVAAAAESL
AKMRVDTATPPALALAERARLAA