Protein Info for SM_b21529 in Sinorhizobium meliloti 1021

Annotation: taurine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF01946: Thi4" amino acids 56 to 103 (48 residues), 26.5 bits, see alignment 9.4e-10 PF01266: DAO" amino acids 59 to 421 (363 residues), 211.7 bits, see alignment E=6e-66 PF00890: FAD_binding_2" amino acids 59 to 108 (50 residues), 21.5 bits, see alignment 3.1e-08 PF13450: NAD_binding_8" amino acids 62 to 97 (36 residues), 22.9 bits, see alignment 2.1e-08

Best Hits

KEGG orthology group: K07256, taurine dehydrogenase large subunit [EC: 1.4.2.-] (inferred from 100% identity to sme:SM_b21529)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UW7 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SM_b21529 taurine dehydrogenase (Sinorhizobium meliloti 1021)
MEHQLARPIASRKPFDPTYDPIRAPNPGDGKDYAPTYWIGTAGTPPADDGPVSGDMDVDV
AIVGSGYTGLSCAIHLAQEHGIKATVLEANGVAWGCSTRNGGQAQISAGRLKRSQWIERW
GVDVAKRLHGEISEAFDLFRDLIRSPEIDCDPQDGGHLYIAHRDKVMPALEAESRLLNEV
FGYRSRIVGRDEVHRDFVRDEEARGAMYEPDGMGIHAAKLAFGYLNLARKLGARVHTASP
VLGCDWKNGAYHLTTPGGTVRARAVCIATAGYTSPDLHTLTRHRLMPILSNSIVTRPLTE
EERAELNFKTRIPLTDTRTLRHYYRMMPDGRVQIGSRSAITGRDAVNPKHLDRLLEGLYR
KYPILKGITIDYSWWGWVDVSHDMMPRIFRPDPKQPLFYAMGYGGNGVMYSAQAGRRMAQ
MVAGKGGALDLPIFTSPLPSHGLLTPFRRLGQWGMYRWYYLKDEIL